PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.004G244800.1
Common NameB456_004G244800, LOC105792562
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 379aa    MW: 42475.9 Da    PI: 8.195
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.004G244800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.38.4e-344498155
             G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                        kprl+Wtp+LHerF+eav+qLGG++kAtPkt+++lm+++gLtl+h+kSHLQkYRl
  Gorai.004G244800.1 44 KPRLKWTPDLHERFIEAVNQLGGADKATPKTVMKLMGIPGLTLYHLKSHLQKYRL 98
                        79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.01441101IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.5E-314299IPR009057Homeodomain-like
SuperFamilySSF466897.53E-174399IPR009057Homeodomain-like
TIGRFAMsTIGR015573.6E-234499IPR006447Myb domain, plants
PfamPF002494.3E-104697IPR001005SANT/Myb domain
PfamPF143796.3E-25144191IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 379 aa     Download sequence    Send to blast
MYHHHQHQGK NINSSSRMAV HNERHLFLQG GHGDSGLMLS TDAKPRLKWT PDLHERFIEA  60
VNQLGGADKA TPKTVMKLMG IPGLTLYHLK SHLQKYRLSK NLHGQTNNGS TKIGAVAMAG  120
KRMSEANGSP MNSLSIGPQA NKGIQIGEAL QMQIEVQRRL HEQLEVQRHL QLRIEAQGKY  180
LQSVLEKAQE TLHRQNLGTV GLEAAKLQLS ELVSKVSNQC LNSAFPDLKD LRGLCCQQTQ  240
QNPPNDCSMD SCLTSCEGSQ RDQEIHNNGM CLRTYNTHKD PLMHHQTETK SSENKTMGND  300
DDDERRMFFA DRNCSDLSMS VGLRGGFSQA RNEEHSFLDV GNKRVDSVNR LPYFATKLDL  360
NVDEKHCKQF DLNGLSWS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012476639.10.0PREDICTED: uncharacterized protein LOC105792562 isoform X1
TrEMBLA0A0D2S5I20.0A0A0D2S5I2_G
STRINGPOPTR_0019s04820.11e-179(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33362764
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04030.31e-150G2-like family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]